PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.G8IB0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 337aa    MW: 37608.3 Da    PI: 6.2647
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.G8IB0genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.69.2e-111445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g W++eEde+l+++++++G g+W+++++  g
      Aradu.G8IB0 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAG 45
                     678*************************9877 PP

2Myb_DNA-binding45.81.4e-144587246
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     g+++++E++l+++++++lG++ W+ Ia+ ++ gRt++++k+ w++
      Aradu.G8IB0 45 GAFSEQEEKLIIELHALLGNR-WSQIAAQLP-GRTDNEIKNLWNS 87
                     78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-14643IPR009057Homeodomain-like
SuperFamilySSF466891.24E-191285IPR009057Homeodomain-like
SMARTSM007176.91345IPR001005SANT/Myb domain
PROSITE profilePS5129420.1273993IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-204590IPR009057Homeodomain-like
PfamPF002496.3E-144588IPR001005SANT/Myb domain
CDDcd001673.94E-104686No hitNo description
SMARTSM007171.1E-84691IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGAFSEQ EEKLIIELHA  60
LLGNRWSQIA AQLPGRTDNE IKNLWNSCLK KKLRQRGIDP NTHQPLSSSN NNDNNNHHQP  120
PTTTTDHPNS SSIDNKESSS TLFLDTPTTT TTTTSSHDIV GYLSFTNNNY GTTPTSLCTS  180
SSSDLNSAMF TSLFPPQIIK PTATTTEPLN WESSSFIDST STIAWGQEST ALEAAQKVDD  240
INKWSEYLNS NINPFFLANN NNTITLPSPS IYTTNDDIVK PETFINVDES STIASWHQTT  300
TSNASTHHQH QPPFQQPSDL YTKDLHTRFS LAFGQTM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1612935108B-MYB
1h8a_C2e-16129325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18894LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351803e-37AC235180.1 Glycine max strain Williams 82 clone GM_WBb0008A05, complete sequence.
GenBankKT0311863e-37KT031186.1 Glycine max clone HN_CCL_14 MYB/HD-like transcription factor (Glyma03g38660.2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016205646.10.0PREDICTED: transcription factor MYB86-like
TrEMBLI1LAY26e-98I1LAY2_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA10G28250.12e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.13e-62myb domain protein 50